PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_10066_f_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family MYB
Protein Properties Length: 558aa    MW: 60566.6 Da    PI: 4.8699
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_10066_f_2genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.98.6e-173885148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ed +l+d+vk++G g+W+++ +  g+ R++k+c++rw ++l
   Neem_10066_f_2 38 KGPWTSAEDAILIDYVKKHGEGNWNAVQKNSGLFRCGKSCRLRWANHL 85
                     79******************************************9986 PP

2Myb_DNA-binding54.52.7e-1791134146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T+eE++l+v++++++G++ W++ a++++ gRt++++k++w++
   Neem_10066_f_2  91 KGAFTQEEEQLIVELHAKMGNK-WARMAAHLP-GRTDNEIKNYWNT 134
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.663385IPR017930Myb domain
SuperFamilySSF466893.37E-3036132IPR009057Homeodomain-like
SMARTSM007178.9E-153787IPR001005SANT/Myb domain
PfamPF002491.1E-143885IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-233992IPR009057Homeodomain-like
CDDcd001671.95E-114085No hitNo description
PROSITE profilePS5129426.70886140IPR017930Myb domain
SMARTSM007173.8E-1790138IPR001005SANT/Myb domain
PfamPF002495.9E-1691134IPR001005SANT/Myb domain
CDDcd001671.90E-1293134No hitNo description
Gene3DG3DSA:1.10.10.605.4E-2693139IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 558 aa     Download sequence    Send to blast
MSRTTIESDD GVLSKDQIES PLNDEGGGIA GRGIALKKGP WTSAEDAILI DYVKKHGEGN  60
WNAVQKNSGL FRCGKSCRLR WANHLRPNLK KGAFTQEEEQ LIVELHAKMG NKWARMAAHL  120
PGRTDNEIKN YWNTRIKRRQ RAGLPLYPPE VSFQVLQESQ SQNINGINSG DKGHHDILQG  180
NGYEIPDVVF DSLKANQSVL PYVPELPDIT ASSMLMKGLG SQYCSFMPPT MHRQKRLRES  240
MPLFAGYSGR IKNEFTFDQF HNDVPDKIAR PFGLSFPLEP DPTPKTPESF GVLQGSHTLS  300
NGNFSASKPT SGAVKLELPS LQYTETDLGS WGTSSSPQPL LETVDAFIQS PPPTGTVDDS  360
DCPSPRNSGL LDALLHEAKT LGCAKNHSSD KSSNSSSVTP ADIADSCTLN ICETEWEDYG  420
DPLSPLGHSA TSLFNECTPL SASGSSLEEQ APIDTLVGCK VKSEPVDQAW SPDRGKETAN  480
LYVSQPDALL ASDWLEQGSA YVKDPTIMTD AIATLLGDDL GSEYKQMTTG TSTSSQGLGL  540
GACAWNNMPA VCQMSDLP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-31361395107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00490DAPTransfer from AT5G06100Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006471261.10.0PREDICTED: transcription factor GAMYB
RefseqXP_006471263.10.0PREDICTED: transcription factor GAMYB
RefseqXP_015383648.10.0PREDICTED: transcription factor GAMYB
TrEMBLA0A067L7W60.0A0A067L7W6_JATCU; MYB family protein
STRINGVIT_13s0067g01630.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38022859
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.31e-144myb domain protein 33